Tesamorelin Australia: Buy Tesamorelin Peptides Online

Shop Tesamorelin 10mg, 5 mg and 20 mg Vials With Lot Data and Identity

Order tesamorelin when the work needs the complete GHRH sequence rather than a truncated fragment. Three fills are held in Australian stock, every lot is documented by HPLC, and the size guide below matches the vial to your study.

What Is Tesamorelin?

Tesamorelin is a man-made copy of GHRH, the 44-amino-acid hormone that switches on growth hormone output, with one small fatty cap added at the front so enzymes cannot dismantle it straight away. The pituitary answers it by letting out growth hormone in its usual rhythm. Of all the GHRH analogues on the market, it is the one with a finished phase 3 programme behind it.

How the tesamorelin peptide works

Native GHRH is cut between its second and third residues, alanine and aspartic acid, by the enzyme DPP-4, and the shortened chain is close to inactive. Tesamorelin answers that with a trans-3-hexenoyl group, a six-carbon acyl chain with one double bond, fixed to the opening tyrosine. The cap leaves the receptor-binding surface untouched, so the molecule still fits the somatotroph receptor for GHRH and still triggers the cyclic AMP signal that releases stored growth hormone.

What makes this route interesting to researchers is the feedback loop it keeps. Growth hormone given directly overrides the system. A GHRH agonist works upstream, so somatostatin and IGF-1 can still rein the pituitary in, and the output stays pulsatile rather than flat.

What the trials measured

The best known data set is a 2007 New England Journal of Medicine trial by Falutz and colleagues. It randomised 412 adults with HIV and abdominal fat accumulation, 275 to tesamorelin and 137 to placebo, for 26 weeks, and measured visceral fat by CT scan at the level of the abdomen. Visceral fat area fell by 27.8 square centimetres in the active group and rose by 5.1 square centimetres with placebo, and the authors also reported better lipid profiles. Later work by Stanley and colleagues extended the question to liver fat in the same population. Every one of those studies sits within an HIV context, and nothing in them describes the compound outside it.

Our practical view: because it is the only GHRH analogue with large controlled trials behind it, tesamorelin makes the most defensible reference agonist when results need to sit beside the clinical literature. Plan by moles, not milligrams. At 5135.9 g/mol it is about 1.5 times heavier than sermorelin, so an equimolar comparison needs roughly half as much mass again. Labs asking for the best peptide to pair with tesamorelin will find the ghrelin receptor partner already combined in the tesamorelin and ipamorelin vial.

Buy Tesamorelin Peptides Online, the Full-Length GHRH Analogue

Theratechnologies in Montreal built tesamorelin by keeping the whole 44 residue human hormone and attaching a single hexenoyl cap to its first amino acid. Native GHRH is cut by DPP-4 within minutes, and the cap slows that cleavage while leaving receptor binding intact. The compound was approved in the United States in 2010 as Egrifta for a narrow indication, and the trial literature behind that decision is one reason tesamorelin is so well represented in published GH axis work.

For a lab, the question it answers is what the complete hormone does at the GHRH receptor when it survives long enough to be measured. Buy it here as a research reagent with no therapeutic standing and no TGA approval, listed among our growth hormone peptides. Every tesamorelin peptide Australia order is drawn from the same tested stock, whichever fill you choose.

Can You Get Tesamorelin in Australia? Egrifta Overseas, Research Vials Here

Whichever fill you pick, 5 mg, 10 mg or 20 mg, the vial holds the same lyophilised white powder and nothing else, ready for a diluent of your choosing. Theratechnologies took the compound, then coded TH9507, through phase 3 trials in the 2000s, and the US Food and Drug Administration approved it on 10 November 2010 as Egrifta, for reducing excess abdominal fat in adults with HIV-associated lipodystrophy. Two reformulations followed in the United States, Egrifta SV and then Egrifta WR, cleared in March 2025, while the European filing was withdrawn in 2012 before a decision.

Australia never received a tesamorelin medicine. A search of the TGA's product information repository returns no tesamorelin or Egrifta document as of October 2026, we found no ARTG registration for it, and no pharmacy product is available to order on prescription. The Poisons Standard does not list tesamorelin by name, but it does not need to: the June 2026 instrument places growth hormone releasing hormones as a class in Schedule 4 and in Appendix D, clause 5, and a GHRH (1-44) analogue sits squarely inside that class. That leaves research suppliers as the only realistic source of tesamorelin Australia laboratories can buy.

WADA names tesamorelin beside sermorelin and CJC-1295 in the GHRH analogue group of class S2 on its 2026 Prohibited List, a ban Sport Integrity Australia applies at all times.

All three sizes of tesamorelin for sale here sit in AminoBlend's Australian stock as laboratory reagents, with checkout open only to adults and use confined to in vitro research, not humans or animals. Groups that want a shorter GHRH comparator alongside it often choose CJC-1295 No DAC in its 10 mg vial.

Order Tesamorelin Australia Stock for Sale in Three Sizes

The tesamorelin buy decision comes down to fill size, because all three vials contain the same peptide made to one specification. The 5 mg vial at $89.99 ($18.00 per mg) suits a pilot or a handling check. The 10 mg vial at $99 ($9.90 per mg) is the standard research fill and the usual first order, since doubling the material adds little to the bill. The 20 mg vial at $179 ($8.95 per mg) is the value pick once a protocol is settled and the full fill can be used inside the 28 days after mixing.

Order several vials of one size in a single checkout and they stay on the same lot wherever stock allows and the same certificate. Labs unsure which fill to take usually start with 10 mg and step up once the method holds. Checkout is restricted to adults aged 18 and over.

Buy Tesamorelin With a Checked Structure, Purity Result and Lot Certificate

The sequence reads YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2, with the trans-3-hexenoyl group on Tyr1. With 44 residues, synthesis leaves more room for deletion and truncated sequences than a short peptide does, and those near-miss products can sit close to the main HPLC peak. That is why the mass result matters as much as the purity figure.

Confirm that the certificate reports a mass consistent with 5135.9 g/mol and an HPLC result for the lot printed on your vial. Reports sit in the COA library by lot number, and the guide to reading a COA explains how the two results fit together.

Order From Tesamorelin Australia Stock Near You and Store the Vial

AminoBlend is an online store with no walk-in counter, so every order ships from one domestic stock to all states and territories. Payment received before 3pm on a business day means the vial is dispatched that afternoon, and you can follow it on track order. Labs needing research peptides in Hobart are supplied from that one stock too.

Reconstitute by bringing the vial to room temperature, adding bacteriostatic water slowly against the glass and swirling rather than shaking. As an example, 2 mL in the 10 mg vial gives 5 mg/mL. The tesamorelin calculator covers the 5 mg and 20 mg fills and any other volume.

Sealed vials keep best at -20 °C in their carton. Mixed solution goes to 2 to 8 °C and should be finished inside 28 days, and aliquots spare the stock from repeated handling. The storage guide explains the difference between powder and solution stability.

Other Names for Tesamorelin

Tesamorelin appears as TH9507 in development papers, as tesamorelin acetate when supplied as the acetate salt, and under the brand name Egrifta in regulatory records. Chemically it is described as N-(trans-3-hexenoyl)-GHRH (1-44) amide, or more loosely as a stabilised human GRF analogue.

Its target is the GHRH receptor, GHRHR, on pituitary somatotrophs. Papers on the downstream axis use GH for growth hormone and IGF-1 for insulin-like growth factor 1, the liver-derived marker most studies measure. Whatever name a protocol uses, the identity check stays the same, a 44 residue chain with a mass near 5135.9 g/mol.

Tesamorelin or Sermorelin, Which to Order

Sermorelin is the native GHRH (1-29) amide with no protection, a 10 mg vial for $89, and its activity lasts only minutes. Tesamorelin keeps the 15 extra residues and adds the cap, so it is longer and more resistant to enzymatic breakdown. Sermorelin suits work that needs the unmodified fragment as a control, while tesamorelin suits work on the complete hormone. Both arrive as powder and mix the same way.

Shop the tesamorelin and ipamorelin blend instead if you also want a ghrelin receptor signal in the same vial, carried at 13 mg plus 3 mg.